Recombinant Protein

ACKR2

C-C chemokine receptor D6 Chemokine receptor CCR-10 Chemokine receptor CCR-9 Chemokine-binding protein 2 Chemokine-binding protein D6 CCBP2, CCR10, CMKBR9, D6

Homo sapiens (Human)

Full Length

46.9 kDa

N-terminal 10xHis-tagged

in vitro E.coli expression system

Greater than 85% as determined by SDS-PAGE.

Tris-based buffer，50% glycerol

Measured by its binding ability in a functional ELISA. Immobilized ACKR2 at 1 μg/ml can bind human CCL2, the EC50 of human CCL2 protein is 23.52-30.99 μg/ml.

"The beta-chemokine receptor D6 is expressed by lymphatic endothelium and a subset of vascular tumors."
Nibbs R.J.B., Kriehuber E., Ponath P.D., Parent D., Qin S., Campbell J.D., Henderson A., Kerjaschki D., Maurer D., Graham G.J., Rot A.
Am. J. Pathol. 158:867-877(2001)

MAATASPQPLATEDADSENSSFYYYDYLDEVAFMLCRKDAVVSFGKVFLPVFYSLIFVLGLSGNLLLLMV
LLRYVPRRRMVEIYLLNLAISNLLFLVTLPFWGISVAWHWVFGSFLCKMVSTLYTINFYSGIFFISCMSL
DKYLEIVHAQPYHRLRTRAKSLLLATIVWAVSLAVSIPDMVFVQTHENPKGVWNCHADFGGHGTIWKLFL
RFQQNLLGFLLPLLAMIFFYSRIGCVLVRLRPAGQGRALKIAAALVVAFFVLWFPYNLTLFLHTLLDLQV
FGNCEVSQHLDYALQVTESIAFLHCCFSPILYAFSSHRFRQYLKAFLAAVLGWHLAPGTAQASLSSCSES
SILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA

Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Acts as a receptor for chemokines including CCL2, CCL3, CCL3L1, CCL4, CCL5, CCL7, CCL8, CCL11, CCL13, CCL17, CCL22, CCL23, CCL24, SCYA2/MCP-1, SCY3/MIP-1-alpha, SCYA5/RANTES and SCYA7/MCP-3. Upon active ligand stimulation, activates a beta-arrestin 1 (ARRB1)-dependent, G protein-independent signaling pathway that results in the phosphorylation of the actin-binding protein cofilin (CFL1) through a RAC1-PAK1-LIMK1 signaling pathway. Activation of this pathway results in up-regulation of ACKR2 from endosomal compartment to cell membrane, increasing its efficiency in chemokine uptake and degradation. By scavenging chemokines in tissues, on the surfaces of lymphatic vessels, and in placenta, plays an essential role in the resolution (termination) of the inflammatory response and in the regulation of adaptive immune responses. Plays a major role in the immune silencing of macrophages during the resolution of inflammation. Acts as a regulator of inflammatory leukocyte interactions with lymphatic endothelial cells (LECs) and is required for immature/mature dendritic cells discrimination by LECs.

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

1-384aa

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Immunology