- Description
- Data Sheet
GFCPDHKAAMVLFLDSVYGIEVQDFLLHLLEVGFLP
DPc10 inactive peptide is a 36-residue peptide that differs from DPc10 (Gly2460-Pro2495, rabbit) at one position (R2475S) and represents the sequence of a known CPVT mutant RyR2 domain. This peptide binds weakly or fails to bind to the DPc10 interface and does NOT affect channel function. It serves as a negative control for research projects using DPc10 peptide.
DPc10 inactive in the current form is not cell permeable. The product is useful in applications that permit access to RyR2 directly (via whole cell patch, skinned cells, black lipid membrane, vesicles, or upon delivery to cytoplasm).
Read DPc10 Publications 
| Peptide name | DPc10 Inactive Peptide |
| Peptide sequence | GFCPDHKAAMVLFLDSVYGIEVQDFLLHLLEVGFLP |
| N-terminus | Amine |
| C-terminus | Acid |
| Counter ions | Trifluroacetate (TFA) |
| Molecular weight | 4034.726 |
| HPLC analysis | Analysis carried out using a 100A 4.6 x 150mm column, gradient from 10% - 90% acetonitrile, in 15 minutes. 60 degC. Purity determined as 95%. |
| MS analysis | Molecular ion predicted: 4034.726. Observed: 4034.1 [M+3H] |
| Appearance | Off white powdered solid |
| Solubilisation | DMSO |
| Storage | Store as supplied at -20°C for up to 1 year. Store desiccated. Make fresh solutions prior to use. |
| Datasheet | A010-515
Read DPc10 Publications
|
| MSDS | A010-515
|
| Notes | The product was purified in acetonitrile and water containing 0.1% trifluoroacetic acid (TFA) prior to lyophilisation. The product will therefore be present as its trifluoroacetic acid salt. *Peptide is supplied by net peptide weight. Whilst the purity of the material has been shown to be >95%, the net peptide content is lower due to counterions and residual water present in the material. To compensate for this the amount of peptide weighed out is adjusted so that the amount of active material received is exactly as stated on the vial. This means that the total mass will be in excess of 200µg, but there will be exactly 200µg of the active peptide in the vial. The remainder of the weight is due to the counter ions and residual water. |
| Regulatory statement | Product for research use only. Not intended for diagnostic or therapeutic use. |
